PDB entry 2e9g

View 2e9g on RCSB PDB site
Description: Solution structure of the alpha adaptinC2 domain from human Adapter-related protein complex 1 gamma 2 subunit
Class: protein binding
Keywords: beta-sandwich, immunoglobulin-like fold, adaptin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2007-01-25, released 2007-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: AP-1 complex subunit gamma-2
  Species: Homo sapiens [TaxId:9606]
  Gene: AP1G2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75843 (7-130)
    • cloning artifact (0-6)
  Domains in SCOPe 2.06: d2e9ga1, d2e9ga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e9gA (A:)
  gssgssgpppapipdlkvferegvqlnlsfirppenpalllititatnfsegdvthficq
  aavpkslqlqlqapsgntvpargglpitqlfrilnpnkaplrlklrltydhfhqsvqeif
  evnnlpveswq