PDB entry 2e31

View 2e31 on RCSB PDB site
Description: Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
Class: ligase
Keywords: ubiquitin, SCF, ubiquitin ligase, fbs1
Deposited on 2006-11-20, released 2007-03-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.236
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box only protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80UW2 (Start-296)
      • see remark 999 (150)
  • Chain 'B':
    Compound: S-phase kinase-associated protein 1A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2e31b1, d2e31b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e31B (B:)
    gphmpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkk
    viqwcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglld
    vtcktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e31B (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgdpvplpnvnaailkkviqwcthhkdd
    ddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnik
    ndfteeeeaqvrk