Lineage for d2e31b2 (2e31 B:85-155)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284712Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1284713Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1284714Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1284740Protein automated matches [226933] (1 species)
    not a true protein
  7. 1284741Species Human (Homo sapiens) [TaxId:9606] [225235] (2 PDB entries)
  8. 1284742Domain d2e31b2: 2e31 B:85-155 [204057]
    Other proteins in same PDB: d2e31b1
    automated match to d1p22b1

Details for d2e31b2

PDB Entry: 2e31 (more details), 2.4 Å

PDB Description: Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
PDB Compounds: (B:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2e31b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e31b2 a.157.1.1 (B:85-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrk

SCOPe Domain Coordinates for d2e31b2:

Click to download the PDB-style file with coordinates for d2e31b2.
(The format of our PDB-style files is described here.)

Timeline for d2e31b2: