PDB entry 2e2m
View 2e2m on RCSB PDB site
Description: Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from Aeropyrum pernix K1 (sulfinic acid form)
Class: oxidoreductase
Keywords: cysteine sulfenic acid, cysteine sulfinic acid, cysteine sulfonic acid, hypervalent sulfur compound, peroxidatic cysteine, OXIDOREDUCTASE
Deposited on
2006-11-14, released
2007-11-20
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: Probable peroxiredoxin
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2e2mj_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
Sequence, based on SEQRES records: (download)
>2e2mJ (J:)
mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
igeglivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakl
lyeearthlh
Sequence, based on observed residues (ATOM records): (download)
>2e2mJ (J:)
sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed
fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllathtvrg
vfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigegliv
pppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllyeea