PDB entry 2dze
View 2dze on RCSB PDB site
Description: Crystal structure of histone chaperone Asf1 in complex with a C-terminus of histone H3
Class: chaperone
Keywords: Immunoglobulin fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE
Deposited on
2006-09-28, released
2007-10-16
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Histone chaperone cia1
Species: Schizosaccharomyces pombe [TaxId:4896]
Gene: cia1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2dzea_ - Chain 'B':
Compound: Histone chaperone cia1
Species: Schizosaccharomyces pombe [TaxId:4896]
Gene: cia1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2dzeb_ - Chain 'X':
Compound: 10-mer peptide from Histone H3.1/H3.2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: PGE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2dzeA (A:)
msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
Sequence, based on observed residues (ATOM records): (download)
>2dzeA (A:)
msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwd
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2dzeB (B:)
msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
Sequence, based on observed residues (ATOM records): (download)
>2dzeB (B:)
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl
nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
- Chain 'X':
No sequence available.