PDB entry 2dw4

View 2dw4 on RCSB PDB site
Description: Crystal structure of human LSD1 at 2.3 A resolution
Class: oxidoreductase
Keywords: demethylase, amine oxidase, chromatin, histone, androgen, fad, corepressor, OXIDOREDUCTASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-08-02, released 2007-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific histone demethylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dw4a1, d2dw4a2, d2dw4a3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dw4A (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpp
    rditaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildw
    hfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavr
    qvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsav
    qrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvagea
    agimenisddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgn
    dydlmaqpitpgpsipgapqpiprlffagehtirnypatvhgallsglreagriadqflg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw4A (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhtaeflvkskhrd
    ltalckeydelaetqgkleeklqeleanppsdvylssrdrqildwhfanlefanatplst
    lslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavrqvrytasgceviavn
    trstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsavqrmgfgnlnkvvlcf
    drvfwdpsvnlfghvgsttasrgelflfwnlapillalvageaagimenisddvivgrcl
    ailkgifgssavpqpketvvsrwradpwargsysyvaagssgndydlmaqpitppiprlf
    fagehtirnypatvhgallsglreagriadqflg