![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.18: SWIRM domain [140222] (4 proteins) Pfam PF04433; contains extra N-terminal helix |
![]() | Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries) Uniprot O60341 169-279 |
![]() | Domain d2dw4a1: 2dw4 A:172-273 [146594] Other proteins in same PDB: d2dw4a2, d2dw4a3 automatically matched to 2IW5 A:171-273 complexed with fad |
PDB Entry: 2dw4 (more details), 2.3 Å
SCOPe Domain Sequences for d2dw4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl
Timeline for d2dw4a1: