PDB entry 2drn

View 2drn on RCSB PDB site
Description: Docking and dimerization domain (D/D) of the Type II-alpha regulatory subunity of protein kinase A (PKA) in complex with a peptide from an A-kinase anchoring protein
Class: transferase
Keywords: AKAP, PKA, NMR, signal transduction, 4-helix bundle, helix-loop-helix, protein-peptide complex, TRANSFERASE
Deposited on 2006-06-11, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Rattus norvegicus [TaxId:10116]
  Gene: RIIA(1-44)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12368 (3-45)
    • see remark 999 (0-2)
  Domains in SCOPe 2.08: d2drna1, d2drna2
• Chain 'B':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Rattus norvegicus [TaxId:10116]
  Gene: RIIA(1-44)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12368 (3-45)
    • see remark 999 (0-2)
  Domains in SCOPe 2.08: d2drnb1, d2drnb2
• Chain 'C':
  Compound: 24-residues peptide from an a-kinase anchoring protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14572 (0-22)
    • see remark 999 (23)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2drnA (A:)
  hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2drnB (B:)
  hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
  

  
  
• Chain 'C':
  No sequence available.