| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) ![]() dimer of identical alpha-hairpin motifs |
| Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
| Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries) |
| Domain d2drna1: 2drn A:2-46 [131672] Other proteins in same PDB: d2drna2, d2drnb2 automatically matched to d1l6ea_ |
PDB Entry: 2drn (more details)
SCOPe Domain Sequences for d2drna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2drna1 a.31.1.1 (A:2-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
Timeline for d2drna1: