PDB entry 2dne

View 2dne on RCSB PDB site
Description: Solution Structure of RSGI RUH-058, a lipoyl domain of human 2-oxoacid dehydrogenase
Class: transferase
Keywords: Lipoyl domain, Lipoic acid, 2-oxoacid dehydrogenase, oxoacid dehydrogenase, Synthesis of acyl CoA, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10515 (7-101)
    • cloning artifact (0-6)
    • cloning artifact (102-107)
  Domains in SCOPe 2.06: d2dnea1, d2dnea2, d2dnea3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dneA (A:)
  gssgssgqkvplpslsptmqagtiarwekkegdkinegdliaevetdkatvgfesleecy
  makilvaegtrdvpigaiicitvgkpedieafknytldssaasgpssg