PDB entry 2dmd

View 2dmd on RCSB PDB site
Description: Solution structure of the N-terminal C2H2 type zinc-binding domain of the Zinc finger protein 64, isoforms 1 and 2
Class: transcription
Keywords: Zinc finger protein 338, ZNF338, Nuclear protein, DNA-binding, Transcription, C2H2-type zinc finger, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-21, released 2006-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 64, isoforms 1 and 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ZFP64
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPA5 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.07: d2dmda1, d2dmda2, d2dmda3, d2dmda4, d2dmda5
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dmdA (A:)
    gssgssgphkcevcgkcfsrkdklkthmrchtgvkpykcktcdyaaadssslnkhlrihs
    derpfkcqicpyasrnssqltvhlrshtgdsgpssg