PDB entry 2dky

View 2dky on RCSB PDB site
Description: Solution structure of the SAM-domain of Rho-GTPase-activating protein 7
Class: signaling protein
Keywords: CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-14, released 2007-04-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Rho-GTPase-activating protein 7
  Species: Homo sapiens [TaxId:9606]
  Gene: DLC1, ARHGAP7, KIAA1723, STARD12
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96QB1 (7-84)
    • cloning artifact (0-6)
    • cloning artifact (85-90)
  Domains in SCOPe 2.04: d2dkya1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dkyA (A:)
  gssgssgmcrkkpdtmiltqieakeacdwlratgfpqyaqlyedflfpidislvkrehdf
  ldrdaiealcrrlntlnkcavmklesgpssg