PDB entry 2dkq

View 2dkq on RCSB PDB site
Description: Solution structure of the PTB domain of KIAA1075 protein from human
Class: signaling protein
Keywords: PTB domain, KIAA1075 protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-13, released 2006-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1075 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TENC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7Z5T9 (7-153)
    • cloning artifact (0-6)
    • cloning artifact (154-159)
  Domains in SCOPe 2.08: d2dkqa1, d2dkqa2, d2dkqa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dkqA (A:)
  gssgssgmstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvh
  fkvsaqgitltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgs
  pwenvchlfaeldpdqpagaivtfitkvllgqrksgpssg