Lineage for d2dkqa1 (2dkq A:8-154)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803423Protein Tensin [141421] (2 species)
  7. 2803426Species Human (Homo sapiens) [TaxId:9606] [141422] (2 PDB entries)
    Uniprot Q9UPS7 1139-1285
    Tensin2
  8. 2803428Domain d2dkqa1: 2dkq A:8-154 [131556]
    Other proteins in same PDB: d2dkqa2, d2dkqa3
    has additional insertions and/or extensions that are not grouped together

Details for d2dkqa1

PDB Entry: 2dkq (more details)

PDB Description: solution structure of the ptb domain of kiaa1075 protein from human
PDB Compounds: (A:) KIAA1075 protein

SCOPe Domain Sequences for d2dkqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]}
mstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvhfkvsaqg
itltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenvch
lfaeldpdqpagaivtfitkvllgqrk

SCOPe Domain Coordinates for d2dkqa1:

Click to download the PDB-style file with coordinates for d2dkqa1.
(The format of our PDB-style files is described here.)

Timeline for d2dkqa1: