PDB entry 2djk

View 2djk on RCSB PDB site
Description: Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
Class: isomerase
Keywords: thioredoxin fold, ISOMERASE
Deposited on 2006-04-04, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein disulfide-isomerase
    Species: Humicola insolens [TaxId:34413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55059 (5-132)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d2djka1, d2djka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2djkA (A:)
    gplgspligeigpetysdymsagiplayifaetaeerkelsdklkpiaeaqrgvinfgti
    dakafgahagnlnlktdkfpafaiqevaknqkfpfdqekeitfeaikafvddfvagkiep
    siksepipekqeg