PDB entry 2djk

View 2djk on RCSB PDB site
Description: Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
Class: isomerase
Keywords: thioredoxin fold, ISOMERASE
Deposited on 2006-04-04, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein disulfide-isomerase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55059 (5-132)
    • cloning artifact (0-4)
  Domains in SCOPe 2.08: d2djka1, d2djka2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2djkA (A:)
  gplgspligeigpetysdymsagiplayifaetaeerkelsdklkpiaeaqrgvinfgti
  dakafgahagnlnlktdkfpafaiqevaknqkfpfdqekeitfeaikafvddfvagkiep
  siksepipekqeg