![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.2: PDI-like [52849] (3 proteins) duplication: contains two tandem repeats of this fold |
![]() | Protein Protein disulfide isomerase, PDI [52850] (5 species) |
![]() | Species Fungus (Humicola insolens) [TaxId:34413] [142357] (3 PDB entries) Uniprot P55059 227-355! Uniprot P55059 350-459 |
![]() | Domain d2djka1: 2djk A:6-133 [131548] Other proteins in same PDB: d2djka2 domain B' only, corresponds to the 3rd domain of yeast PDI (2B5E) |
PDB Entry: 2djk (more details)
SCOPe Domain Sequences for d2djka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2djka1 c.47.1.2 (A:6-133) Protein disulfide isomerase, PDI {Fungus (Humicola insolens) [TaxId: 34413]} pligeigpetysdymsagiplayifaetaeerkelsdklkpiaeaqrgvinfgtidakaf gahagnlnlktdkfpafaiqevaknqkfpfdqekeitfeaikafvddfvagkiepsikse pipekqeg
Timeline for d2djka1: