PDB entry 2diq

View 2diq on RCSB PDB site
Description: Solution structure of the TUDOR domain of Tudor and KH domain containing protein
Class: RNA binding protein
Keywords: NMR, TUDOR domain, Tudor and KH domain containing protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor and KH domain-containing protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TDRKH, TDRD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2W6 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.06: d2diqa1, d2diqa2, d2diqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2diqA (A:)
gssgssgrslqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlen
gnldlyfvdfgdngdcplkdlralrsdflslpfqaiecslariasgpssg