PDB entry 2dig

View 2dig on RCSB PDB site
Description: Solusion structure of the Todor domain of human Lamin-B receptor
Class: DNA binding protein
Keywords: Tudor domain, Integral nuclear envelope inner membrane protein, Nuclear protein, Receptor, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lamin-B receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LBR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14739 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.02: d2diga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2digA (A:)
    gssgssgmpsrkfadgevvrgrwpgsslyyeveilshdstsqlytvkykdgtelelkend
    iksgpssg