PDB entry 2dah

View 2dah on RCSB PDB site
Description: Solution Structure of the C-terminal UBA Domain in the Human Ubiquilin 3
Class: structural genomics, unknown function
Keywords: Ubiquilin-3, UBA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-12-14, released 2006-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquilin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBQLN3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H347 (7-47)
      • cloning artifact (0-6)
      • cloning artifact (48-53)
    Domains in SCOPe 2.07: d2daha1, d2daha2, d2daha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dahA (A:)
    gssgssghfqvqleqlrsmgflnreanlqaliatggdvdaaveklrqssgpssg