PDB entry 2d9t

View 2d9t on RCSB PDB site
Description: Solution structure of the Tudor domain of Tudor domain containing protein 3 from mouse
Class: structural genomics, unknown function
Keywords: Tudor domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor domain-containing protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: Tdrd3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91W18 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-77)
    Domains in SCOPe 2.04: d2d9ta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d9tA (A:)
    gssgssgkvwkpgdecfalywednkfyraevealhssgmtavvkftdygnyeevllsnik
    pvqteawvrdpnsgpssg