PDB entry 2d8z

View 2d8z on RCSB PDB site
Description: Solution structure of the third LIM domain of Four and a half LIM domains protein 2 (FHL-2)
Class: Signaling protein, Structural protein
Keywords: LIM domain, Skeletal muscle LIM-protein 3, LIM-domain protein DRAL, Four and a half LIM domains protein 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Signaling protein, Structural protein
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Four and a half LIM domains 2
  Species: Homo sapiens [TaxId:9606]
  Gene: FHL2
  Database cross-references and differences (RAF-indexed):
  • GB AAH14397 (7-63)
    • cloning artifact (0-6)
    • cloning artifact (64-69)
  Domains in SCOPe 2.06: d2d8za1, d2d8za2, d2d8za3, d2d8za4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d8zA (A:)
  gssgssgcvqckkpittggvtyreqpwhkecfvctacrkqlsgqrftarddfayclncfc
  dlyasgpssg