PDB entry 2d82

View 2d82 on RCSB PDB site
Description: Target Structure-Based Discovery of Small Molecules that Block Human p53 and CREB Binding Protein (CBP) Association
Class: Transferase
Keywords: Bromodomain, CREB, CBP, NMR structure, p53, Chemical Ligand, 9-Acetyl-2,3,4,9-tetrahydro-carbazol-1-one, Transferase
Deposited on 2005-12-01, released 2006-04-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (4-120)
      • cloning artifact (0-3)
    Domains in SCOPe 2.04: d2d82a_
  • Heterogens: TTR

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d82A (A:)
    gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
    tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
    g