PDB entry 2d2v

View 2d2v on RCSB PDB site
Description: X-ray structure of the sucrose-phosphatase (SPP) from Synechocystis sp.PCC6803 in complex with maltose
Class: hydrolase
Keywords: phosphohydrolase, HAD superfamily, maltose, cyanobacteria, HYDROLASE
Deposited on 2005-09-16, released 2006-09-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein slr0953
    Species: Synechocystis sp. [TaxId:1148]
    Gene: spp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2va_
  • Heterogens: MAL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d2vA (A:)
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls