PDB entry 2cy2

View 2cy2 on RCSB PDB site
Description: Crystal structure of TTHA1209 in complex with acetyl coenzyme A
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-07-04, released 2006-01-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable acetyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1209
    Database cross-references and differences (RAF-indexed):
    • GB YP_144475 (0-173)
      • modified residue (124)
    Domains in SCOPe 2.04: d2cy2a1
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cy2A (A:)
    vrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrl
    fvaesesgevvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqae
    gygrmlvwvlkenpkgrgfyehlggvllgereielggaklwevaygfdlgghkw