PDB entry 2cvr

View 2cvr on RCSB PDB site
Description: NMR solution structure of sso7d mutant, K12L, 12 conformers
Class: DNA binding protein
Keywords: DNA-binding protein, thermostable protein, Sulfolobus solfataricus, single point mutation, DNA BINDING PROTEIN
Deposited on 2005-06-13, released 2006-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein 7a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61991 (0-61)
      • engineered (11)
    Domains in SCOPe 2.04: d2cvra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cvrA (A:)
    atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qk