PDB entry 2cu6

View 2cu6 on RCSB PDB site
Description: Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8
Class: structural genomics, unknown function
Keywords: Thermus Thermophilus HB8, dTDP-4-keto-L-rhamnose reductase-related protein, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-25, released 2005-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dTDP-4-keto-L-rhamnose reductase-related Protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53W28
      • modified residue (46)
    Domains in SCOPe 2.05: d2cu6a1
  • Chain 'B':
    Compound: dTDP-4-keto-L-rhamnose reductase-related Protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53W28
      • modified residue (46)
    Domains in SCOPe 2.05: d2cu6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2cu6A (A:)
mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg

    Sequence, based on observed residues (ATOM records): (download) 
    >2cu6A (A:)
pleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavr
qalsrlpgveevevevtfeppwtlarlseka

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2cu6B (B:)
mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg

    Sequence, based on observed residues (ATOM records): (download) 
    >2cu6B (B:)
pleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavr
qalsrlpgveevevevtfeppwtlarlseka