Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.2: PaaD-like [117922] (3 proteins) Pfam PF01883; DUF59 |
Protein automated matches [190571] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187567] (4 PDB entries) |
Domain d2cu6b_: 2cu6 B: [130804] Other proteins in same PDB: d2cu6a1 automated match to d2cu6a1 |
PDB Entry: 2cu6 (more details), 2 Å
SCOPe Domain Sequences for d2cu6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu6b_ d.52.8.2 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} pleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavr qalsrlpgveevevevtfeppwtlarlseka
Timeline for d2cu6b_: