SCOPe 2.05: Domain d2cu6b_: 2cu6 B:

Lineage for d2cu6b_ (2cu6 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.2: PaaD-like [117922] (3 proteins)
   Pfam PF01883; DUF59

6. Protein automated matches [190571] (1 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187567] (4 PDB entries)

8. Domain d2cu6b_: 2cu6 B: [130804]
   Other proteins in same PDB: d2cu6a1
   automated match to d2cu6a1

Details for d2cu6b_

PDB Entry: 2cu6, 2 Å

PDB Description: Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8

PDB Compounds: (B:) dTDP-4-keto-L-rhamnose reductase-related Protein

SCOPe Domain Sequences for d2cu6b_:

Sequence; same for both SEQRES and ATOM records:

>d2cu6b_ d.52.8.2 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavr
qalsrlpgveevevevtfeppwtlarlseka

Timeline for d2cu6b_:

• d2cu6b_ first appeared in SCOP 1.73, called d2cu6b1
  
• d2cu6b_ appears in SCOPe 2.04
  
• d2cu6b_ appears in SCOPe 2.06
  
• d2cu6b_ appears in the current release, SCOPe 2.08