PDB entry 2ctj

View 2ctj on RCSB PDB site
Description: Solution structure of the 8th KH type I domain from human Vigilin
Class: transport protein
Keywords: K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-beta-alpha structure, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vigilin
    Species: Homo sapiens [TaxId:9606]
    Gene: HDLBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00341 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.02: d2ctja1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ctjA (A:)
    gssgssgsiqkdlaniaevevsipaklhnsligtkgrlirsimeecggvhihfpvegsgs
    dtvvirgpssdvekakkqllhlaeekqtksgpssg