PDB entry 2ct1

View 2ct1 on RCSB PDB site
Description: Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein
Class: Transcription
Keywords: Transcriptional repressor CTCF, CCCTC-binding factor, zinc finger, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor CTCF
    Species: Homo sapiens [TaxId:9606]
    Gene: Ctcf
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49711 (7-70)
      • cloning artifact (0-6)
      • cloning artifact (71-76)
    Domains in SCOPe 2.04: d2ct1a1, d2ct1a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ct1A (A:)
    gssgssgrthsgekpyecyicharftqsgtmkmhilqkhtenvakfhcphcdtviarksd
    lgvhlrkqhsysgpssg