PDB entry 2csp

View 2csp on RCSB PDB site
Description: Solution structure of the FNIII domain of human RIM-binding protein 2
Class: endocytosis/exocytosis
Keywords: fn3 domain, RIM binding protein 2, RIM-BP2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-05-22, released 2005-11-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIM binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hg00364
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15034 (7-123)
    • cloning artifact (0-6)
    • cloning artifact (124-129)
  Domains in SCOPe 2.04: d2cspa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cspA (A:)
  gssgssgvefstlpagppappqdvtvqagvtpatirvswrppvltptglsnganvtgygv
  yakgqrvaevifptadstavelvrlrsleakgvtvrtlsaqgesvdsavaavppellvpp
  tphpsgpssg