PDB entry 2cs0

View 2cs0 on RCSB PDB site
Description: Solution structure of the SH2 domain of human HSH2D protein
Class: signaling protein
Keywords: ALX, FLJ14886, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hematopoietic SH2 domain containing
  Species: HOMO SAPIENS
  Gene: HSH2D
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96JZ2 (7-112)
    • cloning artifact (0-6)
    • cloning artifact (113-118)
  Domains in SCOP 1.75: d2cs0a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cs0A (A:)
  gssgssggqlaqdgvpewfhgaisredaenllesqplgsflirvshshvgytlsykaqss
  cchfmvkllddgtfmipgekvahtsldalvtfhqqkpieprrelltqpcrqkdsgpssg