Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (34 proteins) Pfam PF00017 |
Protein Hematopoietic SH2 domain containing protein HSH2D [143623] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143624] (1 PDB entry) Uniprot Q96JZ2 24-129 |
Domain d2cs0a1: 2cs0 A:8-113 [130744] |
PDB Entry: 2cs0 (more details)
SCOP Domain Sequences for d2cs0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} gqlaqdgvpewfhgaisredaenllesqplgsflirvshshvgytlsykaqsscchfmvk llddgtfmipgekvahtsldalvtfhqqkpieprrelltqpcrqkd
Timeline for d2cs0a1: