Lineage for d2cs0a1 (2cs0 A:8-113)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868294Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 868295Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 868296Family d.93.1.1: SH2 domain [55551] (34 proteins)
    Pfam PF00017
  6. 868492Protein Hematopoietic SH2 domain containing protein HSH2D [143623] (1 species)
  7. 868493Species Human (Homo sapiens) [TaxId:9606] [143624] (1 PDB entry)
    Uniprot Q96JZ2 24-129
  8. 868494Domain d2cs0a1: 2cs0 A:8-113 [130744]

Details for d2cs0a1

PDB Entry: 2cs0 (more details)

PDB Description: solution structure of the sh2 domain of human hsh2d protein
PDB Compounds: (A:) Hematopoietic SH2 domain containing

SCOP Domain Sequences for d2cs0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]}
gqlaqdgvpewfhgaisredaenllesqplgsflirvshshvgytlsykaqsscchfmvk
llddgtfmipgekvahtsldalvtfhqqkpieprrelltqpcrqkd

SCOP Domain Coordinates for d2cs0a1:

Click to download the PDB-style file with coordinates for d2cs0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cs0a1: