PDB entry 2crd

View 2crd on RCSB PDB site
Description: analysis of side-chain organization on a refined model of charybdotoxin: structural and functional implications
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1993-02-17, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: charybdotoxin
  Species: Leiurus quinquestriatus [TaxId:6884]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13487 (1-36)
  Domains in SCOPe 2.07: d2crda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2crdA (A:)
  eftnvscttskecwsvcqrlhntsrgkcmnkkcrcys