PDB entry 2cqh

View 2cqh on RCSB PDB site
Description: Solution structure of the RNA binding domain of IGF-II mRNA-binding protein 2
Class: RNA Binding Protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA Binding Protein
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IGF-II mRNA-binding protein 2 isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: Imp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6M1 (7-86)
      • cloning artifact (0-6)
      • cloning artifact (87-92)
    Domains in SCOPe 2.07: d2cqha1, d2cqha2, d2cqha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cqhA (A:)
gssgssgmnklyignlspavtaddlrqlfgdrklplagqvllksgyafvdypdqnwaira
ietlsgkvelhgkimevdysvskklrssgpssg