PDB entry 2cq0

View 2cq0 on RCSB PDB site
Description: solution structure of RNA binding domain in eukaryotic translation initiation factor 3 subunit 4
Class: transcription
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Eukaryotic translation initiation factor 3 subunit 4
  Species: Homo sapiens [TaxId:9606]
  Gene: EIF3S4
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75821 (7-96)
    • cloning artifact (0-6)
    • cloning artifact (97-102)
  Domains in SCOPe 2.07: d2cq0a1, d2cq0a2, d2cq0a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cq0A (A:)
  gssgssgpnrraddnatirvtnlsedtretdlqelfrpfgsisriylakdkttgqskgfa
  fisfhrredaaraiagvsgfgydhlilnvewakpstnsgpssg