PDB entry 2cot

View 2cot on RCSB PDB site
Description: Solution structure of the first and second zf-C2H2 domain of Zinc finger protein 435
Class: Transcription
Keywords: ADK_lid domain, Zinc finger protein 435, Zinc finger and SCAN domain containing protein 16, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transcription
Deposited on 2005-05-18, released 2005-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein 435
  Species: Homo sapiens [TaxId:9606]
  Gene: ZNF435, ZSCAN16
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H4T2 (7-70)
    • cloning artifact (0-6)
    • cloning artifact (71-76)
  Domains in SCOPe 2.08: d2cota1, d2cota2, d2cota3, d2cota4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cotA (A:)
  gssgssgrsewqqrerrrykcdecgksfshssdlskhrrthtgekpykcdecgkafiqrs
  hlighhrvhtgsgpssg