PDB entry 2cob

View 2cob on RCSB PDB site
Description: Solution structures of the HTH domain of human LCoR protein
Class: DNA binding protein
Keywords: MLR2, KIAA1795, helix-turn-helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LCoR protein
  Species: Homo sapiens [TaxId:9606]
  Gene: MLR2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5VW16 (7-69)
    • cloning artifact (0-6)
  Domains in SCOPe 2.08: d2coba1, d2coba2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cobA (A:)
  gssgssgrgryrqynseileeaisvvmsgkmsvskaqsiygiphstleykvkerlgtlkn
  ppkkkmklmr