![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.15: Psq domain [140213] (1 protein) Pfam PF05225 |
![]() | Protein Ligand-dependent corepressor (LCoR) [140214] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140215] (1 PDB entry) Uniprot Q96JN0 343-405 |
![]() | Domain d2coba1: 2cob A:8-70 [130673] Other proteins in same PDB: d2coba2 |
PDB Entry: 2cob (more details)
SCOPe Domain Sequences for d2coba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} rgryrqynseileeaisvvmsgkmsvskaqsiygiphstleykvkerlgtlknppkkkmk lmr
Timeline for d2coba1: