SCOPe 2.08: Domain d2coba1: 2cob A:8-70

Lineage for d2coba1 (2cob A:8-70)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.15: Psq domain [140213] (1 protein)
   Pfam PF05225

6. Protein Ligand-dependent corepressor (LCoR) [140214] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140215] (1 PDB entry)
   Uniprot Q96JN0 343-405

8. Domain d2coba1: 2cob A:8-70 [130673]
   Other proteins in same PDB: d2coba2

Details for d2coba1

PDB Entry: 2cob

PDB Description: solution structures of the hth domain of human lcor protein

PDB Compounds: (A:) LCoR protein

SCOPe Domain Sequences for d2coba1:

Sequence; same for both SEQRES and ATOM records:

>d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]}
rgryrqynseileeaisvvmsgkmsvskaqsiygiphstleykvkerlgtlknppkkkmk
lmr

Timeline for d2coba1:

• d2coba1 first appeared in SCOP 1.73
  
• d2coba1 appears in SCOPe 2.07