PDB entry 2cku

View 2cku on RCSB PDB site
Description: solution structure of 2f13f1 from human fibronectin
Class: signaling protein
Keywords: glycoprotein, cell adhesion, phosphorylation, pyrrolidone carboxylic acid, signaling protein, sulfation, acute phase, fibronectin, module pair, heparin-binding, alternative splicing
Deposited on 2006-04-21, released 2007-04-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (Start-89)
  Domains in SCOPe 2.02: d2ckua1, d2ckua2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ckuA (A:)
  aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigd
  twrrphetggymlecvclgngkgewtckpi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ckuA (A:)
  eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigdt
  wrrphetggymlecvclgngkgewtckpi