PDB entry 2cju

View 2cju on RCSB PDB site
Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq16-113.8 scfv in complex with phoxgaba
Class: immune system
Keywords: scfv, antibody, immunoglobulin, 2-phenyl-5-oxazolone, immunoglobulin domain, immune system
Deposited on 2006-04-09, released 2006-06-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: nq16-113.8 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJU (0-114)
    Domains in SCOPe 2.03: d2cjuh_
  • Chain 'L':
    Compound: nq16-113.8 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.03: d2cjul_
  • Heterogens: PHX, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjuH (H:)
    evklvesggglvqpggslrlscatsgftftnyymnwvrqppgkalewlvsirnkangytt
    dysasvkgrftisrdnsqsilylemnnlraedsatyycargygygawfaywgqgtlvtvs
    a
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjuL (L:)
    qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr