SCOPe 2.03: Domain d2cjul_: 2cju L:

Lineage for d2cjul_ (2cju L:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)

8. Domain d2cjul_: 2cju L: [197833]
   automated match to d1fvcc_
   complexed with phx

Details for d2cjul_

PDB Entry: 2cju, 2.5 Å

PDB Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq16- 113.8 scfv in complex with phoxgaba

PDB Compounds: (L:) nq16-113.8 anti-phox antibody

SCOPe Domain Sequences for d2cjul_:

Sequence; same for both SEQRES and ATOM records:

>d2cjul_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr

Timeline for d2cjul_:

• d2cjul_ is new in SCOPe 2.03-stable
  
• d2cjul_ appears in SCOPe 2.04
  
• d2cjul_ appears in the current release, SCOPe 2.08