PDB entry 2cj2

View 2cj2 on RCSB PDB site
Description: chloroperoxidase complexed with formate (sugar cryoprotectant)
Class: oxidoreductase
Keywords: oxidoreductase, heme, iron, chloride, manganese, peroxidase, pyrrolidone carboxylic acid, glycoprotein, metal-binding
Deposited on 2006-03-26, released 2006-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: CALDARIOMYCES FUMAGO [TaxId:5474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cj2a1, d2cj2a2
  • Heterogens: MN, HEM, NAG, MAN, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cj2A (A:)
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd