SCOPe 2.08: Domain d2cj2a1: 2cj2 A:0-119

Lineage for d2cj2a1 (2cj2 A:0-119)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.3: Cloroperoxidase [47571] (1 family)
   duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each

5. Family a.39.3.1: Cloroperoxidase [47572] (1 protein)

6. Protein Cloroperoxidase [47573] (1 species)

7. Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries)

8. Domain d2cj2a1: 2cj2 A:0-119 [130514]
   automated match to d1cpoa1
   complexed with fmt, hem, man, mn, nag

Details for d2cj2a1

PDB Entry: 2cj2, 1.6 Å

PDB Description: chloroperoxidase complexed with formate (sugar cryoprotectant)

PDB Compounds: (A:) chloroperoxidase

SCOPe Domain Sequences for d2cj2a1:

Sequence; same for both SEQRES and ATOM records:

>d2cj2a1 a.39.3.1 (A:0-119) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva

Timeline for d2cj2a1:

• d2cj2a1 first appeared in SCOP 1.73
  
• d2cj2a1 appears in SCOPe 2.07