PDB entry 2cg6

View 2cg6 on RCSB PDB site
Description: Second and third fibronectin type I module pair (crystal form I).
Class: signaling protein
Keywords: cell adhesion, glycoprotein, heparin-binding, signaling protein, acute phase, alternative splicing, phosphorylation, pyrrolidone carboxylic acid, sulfation
Deposited on 2006-02-27, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human fibronectin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-89)
  Domains in SCOPe 2.07: d2cg6a1, d2cg6a2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cg6A (A:)
  aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigd
  twrrphetggymlecvclgngkgewtckpi