PDB entry 2c7r

View 2c7r on RCSB PDB site
Description: HhaI DNA methyltransferase complex with oligonucleotide containing 2- aminopurine as a target base (GPGC:GMGC) and SAH
Class: transferase/DNA
Keywords: base flipping, restriction system, transferase-DNA complex, transferase
Deposited on 2005-11-27, released 2005-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05102 (0-326)
      • engineered mutation (249)
    Domains in SCOPe 2.08: d2c7ra_
  • Chain 'C':
    Compound: 5'-d(*g*gp*ap*tp*gp*(5cm)*gp*cp*tp*gp*ap*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: 5'-d(*g*tp*cp*ap*gp*(2pr)*gp*cp*ap*tp*cp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: SAH, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c7rA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaiglsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.