Lineage for d2c7ra_ (2c7r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893725Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 2893770Protein automated matches [190244] (3 species)
    not a true protein
  7. 2893775Species Haemophilus haemolyticus [TaxId:726] [187017] (6 PDB entries)
  8. 2893777Domain d2c7ra_: 2c7r A: [130082]
    automated match to d10mha_
    protein/DNA complex; complexed with gol, sah, so4

Details for d2c7ra_

PDB Entry: 2c7r (more details), 1.9 Å

PDB Description: HhaI DNA methyltransferase complex with oligonucleotide containing 2- aminopurine as a target base (GPGC:GMGC) and SAH
PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2c7ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7ra_ c.66.1.26 (A:) automated matches {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaiglsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d2c7ra_:

Click to download the PDB-style file with coordinates for d2c7ra_.
(The format of our PDB-style files is described here.)

Timeline for d2c7ra_: