PDB entry 2c7l

View 2c7l on RCSB PDB site
Description: low temperature structure of phycoerythrocyanin from mastigocladus laminosus
Class: electron transport
Keywords: phycoerythrocyanin, phycoviolobilin, phycocyanobilin, bile pigment, chromophore, electron transport, photosynthesis, phycobilisome, antenna protein
Deposited on 2005-11-25, released 2006-01-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.2157
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phycoerythrocyanin alpha chain
    Species: MASTIGOCLADUS LAMINOSUS [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c7la_
  • Chain 'B':
    Compound: phycoerythrocyanin beta chain
    Species: MASTIGOCLADUS LAMINOSUS [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c7lb_
  • Heterogens: BLA, CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c7lA (A:)
mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
alglspswyiaalefvrdnhgltgdvageantyinyainals

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c7lB (B:)
mldafsrvveqadkkgaylsndeinalqaivadsnkrldvvnrltsnassivanayralv
aerpqvfnpggpcfhhrnqaacirdlgfilryvtysvlagdtsvmddrclnglretyqal
gtpgdavasgikkmkeaalkiandpngitkgdcsqlmselasyfdraaaava