![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
![]() | Protein automated matches [190531] (6 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [187515] (2 PDB entries) |
![]() | Domain d2c7lb_: 2c7l B: [163288] automated match to d1i7yb_ complexed with bla, cyc |
PDB Entry: 2c7l (more details), 2.85 Å
SCOPe Domain Sequences for d2c7lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7lb_ a.1.1.3 (B:) automated matches {Mastigocladus laminosus [TaxId: 83541]} mldafsrvveqadkkgaylsndeinalqaivadsnkrldvvnrltsnassivanayralv aerpqvfnpggpcfhhrnqaacirdlgfilryvtysvlagdtsvmddrclnglretyqal gtpgdavasgikkmkeaalkiandpngitkgdcsqlmselasyfdraaaava
Timeline for d2c7lb_: