PDB entry 2c2c

View 2c2c on RCSB PDB site
Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2
Deposited on 1983-11-03, released 1984-02-02
The last revision prior to the SCOP 1.59 freeze date was dated 1984-02-02, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2c2c__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c2c_ (-)
    egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
    twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk