PDB entry 2c0s

View 2c0s on RCSB PDB site
Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
Class: transferase
Keywords: transferase, phosphatase, phosphorylation, sporulation, bacillus anthracis, antithetical, negative regulator, spine
Deposited on 2005-09-07, released 2006-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved domain protein
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81XQ9 (0-56)
    • PDB 2C0S (57-63)
    Domains in SCOPe 2.07: d2c0sa1, d2c0sa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c0sA (A:)
    mnvtklndrieakkkeliylvekygfthhkvisfsqeldrllnllielktkkkryslleh
    hhhh